iskenderiye.net

 (visit site)
0
trailers

Social Media Analysis

Iskenderiye.net has over 0 followers on popular social networking platforms such as Facebook. It has been bookmarked over 2 times across major social bookmarking services such as Delicious. Iskenderiye.net has been mentioned at least 2 times throughout top social news destinations such as Google News. Over 3 discussions are happening around iskenderiye.net on the web.

Networking

0 twitter followers
0 facebook likes
0 myspace results
0 bebo results

Bookmarking

2 delicious bookmarks
0 bibsonomy bookmarks
0 folkd bookmarks

Media

0 youtube videos
0 flickr pictures
7 dailymotion videos

News

0 google stories
0 yahoo stories
0 digg submissions
0 reddit submissions
0 topix stories
2 topsy mentions

Other

0 yahoo questions
0 google groups
3 wikipedia articles
0 livejournal entries
Social Media Score Widget
Place this interactive always-updated SiteTrail social media score widget on your site. Just copy and paste the html.

SEO Analysis

Iskenderiye.net has an average of 2 pages indexed in major search engines like Google, Yahoo and Bing. There are an average of 0 links pointing back to iskenderiye.net from other websites around the world. There are a total of 1 listings about iskenderiye.net in DMOZ (0 categories) and Yahoo! Directory.

Indexed Pages

0 google pages
0 yahoo pages
7 bing pages

Backlinks

0 google backlinks
0 yahoo backlinks
0 bing backlinks
23 alexa backlinks
3/10 google pagerank

Last Crawled

Not available
May 23, 2011 (12:00 AM UTC)
Not available

Directories

0 dmoz listings
1 yahoo listings

Other

0 allow, 7 disallow, 0 sitemap, 1 user-agent, 0 crawl-delay
Invalid, 13 errors, 8 warnings, utf-8 charset

DMOZ Categories

DMOZ categories for iskenderiye.net are not available.
SEO Score Widget
Place this interactive always-updated SiteTrail SEO score widget on your site. Just copy and paste the html.

Visitor Analysis

Every month, 694 unique visitors visit iskenderiye.net, each of whom come back to the site 1.0 times. Majority of them (51.5%) come from the United States region and 0 have subscribed via RSS.

Visitors

1,387 compete visitors
0 quantcast visitors

Visits

1,387 compete visits
0 quantcast visits

Pageviews

27,010 pageviews

Syndication

0 rss subscribers

Visitor Countries

United States
51.5%
Turkey
24%

Traffic Analysis

On average, iskenderiye.net is ranked #851,703 across major traffic ranking services such as Alexa and Compete. This metric shows the popularity of iskenderiye.net compared to other sites around the web.

Traffic Ranks

#1,667,833 alexa rank
#887,276 compete rank
#0 quantcast rank

Blog Rank

#0 technorati rank

Rank Trend

Visitor Trend

Bounce Trend

Traffic Rank Widget
Place this interactive always-updated SiteTrail traffic rank widget on your site. Just copy and paste the html.

Revenue Analysis

Iskenderiye.net has the potential to earn $599 USD in advertisement revenue per year. If the site was up for sale, it would be worth approximately $1,078 USD.

Revenue

$2 USD per day
$50 USD per month
$599 USD per year

Worth

$1,078 USD
Value Widget
Place this interactive always-updated SiteTrail value widget on your site. Just copy and paste the html.

Content Analysis

Iskenderiye.net's home page is 599 bytes in size. It has 0 (0% have "alt" attribute). Out of the 10 unique keywords found on iskenderiye.net, "functionrequire failed" was the most dense.

Title

Not available

Meta Description

Not available

Meta Keywords

Not available

Page Size

0.60 KB

Images

0 JPG, 0 GIF, 0 PNG
0 alt tags, 0 title tags
0 internal, 0 external
0 total

Keyword Density

functionrequire failed
20%
homenurierdemiskenderiyenetwpsettingsphp line
20%

Link Analysis

The home page of iskenderiye.net links to 2 web pages, 0 of which point to external sites. The page also 2 anchor texts of which 0 are nofollow.

Internal

2 follow, 0 nofollow
2 anchor tags, 0 title tags
2 total

Outbound

0 follow, 0 nofollow
0 anchor tags, 0 title tags
0 total

Anchor Texts

  • function.require

Outbound Domains

Not available

Hosting Analysis

The primary web hosting server where iskenderiye.net is hosted resolves to the IP address 67.205.31.118 and is located at Brea, California, United States.

IP Address

67.205.31.118

IP Decimal (Long)

1137516406

Reverse IP

apache2-ogle.dalitz.dreamhost.com

Server Location

Brea, California
United States (92821)
33.9269 (lat) / -117.861 (long)

Hosting Company

New Dream Network, LLC
417 Associated Rd.
PMB #257
Brea, CA (92821)
United States

Domain Analysis

The iskenderiye.net domain name was registered about 4 decades ago in 1970. It will expire in 4 decades ago and was last updated 4 decades ago.

Domain Status

Created:
Jan 1, 1970

Registrar

Network Solutions

Nameservers

Not available

Registrant Contact

- +1.8437575109
David Golding
250 layne blvd
Hallandale,FL,US 30009

Admin Contact

Not available

Technical Contact

Not available

Server Analysis

On average, iskenderiye.net web pages load in 5858 milliseconds. The site uses about 2 different types of web software that we know of and consists of about 0% JavaScript code.

Software Used

  • WordPress (cms)
  • Apache (server)

Languages Used

  • HTML (100%)
  • JavaScript (0%)
  • CSS (0%)

Page Speed

5.858 seconds

Color Analysis

The top colors used in iskenderiye.net's web template color pallete are light grey, very light pink, silver. Typically, lighter colored websites are more trustworthy and easier to use.
#DCDEDC
Light Grey
#DCDADC
Light Grey
#D4D6D4
Light Grey
#D4D2D4
Light Grey
#E4E2E4
Light Grey
#ECEEEC
Very Light Pink
#E4E6E4
Light Grey
#CCCECC
Silver
#ECEAEC
Very Light Pink
#CCCACC
Silver

DNS Record Analysis

Iskenderiye.net has 1 address (A) records, 3 name server (NS) records, 1 start of authority (SOA) records, 1 mail exchanger (MX) records and 0 text (TXT) records in its domain name system (DNS).
HostClassTypeIPTTLTargetOther
iskenderiye.netINA67.205.31.11814399
iskenderiye.netINNS14400ns1.dreamhost.com
iskenderiye.netINNS14400ns2.dreamhost.com
iskenderiye.netINNS14400ns3.dreamhost.com
iskenderiye.netINSOA14400mname: ns1.dreamhost.com
rname: hostmaster.dreamhost.com
serial: 2010080400
refresh: 16119
retry: 1800
expire: 1814400
minimum-ttl: 14400
iskenderiye.netINMX14400aspmx.l.google.compri: 0

HTTP Header Analysis

HTTP header reponses show how iskenderiye.net responds to incoming Hyper Text Transfer Protocol (HTTP) requests from connecting clients (e.g. web browsers).
HTTP/1.1 301 Moved Permanently
Date: Thu, 26 May 2011 20:46:49 GMT
Server: Apache
Location: http://www.iskenderiye.net/
Vary: Accept-Encoding
Content-Length: 235
Connection: close
Content-Type: text/html; charset=iso-8859-1

HTTP/1.1 200 OK
Date: Thu, 26 May 2011 20:46:50 GMT
Server: Apache
Vary: Accept-Encoding
Content-Length: 599
Connection: close
Content-Type: text/html
Own this website?
Place this interactive always-updated SiteTrail value widget on your site. Just copy the html and put it on your site.
This data was last updated 3 years ago
(update data).

User reviews of iskenderiye.net

comments powered by Disqus

Popular Sites

    Featured Sites

      Recent Lookups

      Share on Facebook Share on Twitter Digg This Add to Delicious Email to Friend More...